This is a working overview of analytical standard, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-08-15. Anything still debated is marked as such rather than presented as settled.
Most published work on SR9009 consists of preclinical studies. It is widely sold as a research chemical, a category that does not imply safety, efficacy, or pharmaceutical-grade quality. Sports anti-doping organizations have listed SR9009 as a prohibited substance, and its presence in an athlete sample can lead to sanctions. Legal status differs by country; in several jurisdictions it is not approved for human consumption and may be treated as an unapproved new drug.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
Regulatory status varies by country and intended use. Major drug agencies have not granted marketing authorization for SR9009 as a medicine, and it is not listed as a controlled substance in many jurisdictions. It is often sold as a research chemical, a category that may fall outside pharmaceutical manufacturing rules. Buyers should verify local laws and supplier documentation, including certificates of analysis. The lack of standardized quality controls raises concerns about identity, purity, and actual content in products marketed online.
In laboratory settings, SR9009 is commonly identified by its molecular structure and its interaction with REV-ERB receptors. Vendors may list it under synonyms such as Stenabolic or REV-ERB agonist, but those names do not define purity or identity. Analytical confirmation typically uses high-performance liquid chromatography with ultraviolet detection or liquid chromatography–mass spectrometry. A reference standard is needed to compare retention time and mass spectrum, because the compound can be confused with related research chemicals.
Handling practices for SR9009 focus on minimizing degradation and contamination. The solid is generally stored desiccated at or below -20 °C, protected from light and moisture. Stock solutions are often prepared in dimethyl sulfoxide or ethanol, then aliquoted to avoid repeated freeze–thaw cycles. Aqueous solubility is low, so formulations for animal studies may require cosolvents or suspending agents. Personnel should follow institutional chemical safety procedures, because toxicological data for humans are incomplete.
| Property | Value | Notes |
|---|---|---|
| Common name | SR9009 | Also referred to as Stenabolic in non-scientific contexts. |
| Chemical class | Synthetic small molecule | Not a steroid or peptide hormone. |
| Receptor target | REV-ERBα and REV-ERBβ | Nuclear receptor agonist in preclinical studies. |
| Development status | Investigational | No approved human therapeutic indication. |
| Regulatory attention | Prohibited in sport | Listed by anti-doping authorities. |
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
Handling recommendations for SR9009 in a laboratory setting include storing the solid at low temperature, protected from light and moisture. The compound is often dissolved in dimethyl sulfoxide or ethanol for experiments. Solutions should be prepared with appropriate personal protective equipment and disposed of according to local rules. Stability data for long-term storage are limited, so stock solutions are typically kept cold and used within defined periods. Records of preparation date and concentration support reproducibility.
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
SR9009 is supplied as a solid research chemical, often in milligram quantities. Laboratories typically weigh it in a controlled environment because fine powders can disperse. Stock solutions are commonly prepared in dimethyl sulfoxide and stored in small aliquots to reduce freeze-thaw cycles. Personal protective equipment and chemical fume hoods are standard when handling unknown or potent compounds. These practices address laboratory safety rather than human use.
Mechanistically, SR9009 binds the ligand-binding domain of REV-ERBα/β and enhances recruitment of corepressor complexes. This represses target genes rather than activating them. Because REV-ERB proteins normally compete with ROR proteins at shared response elements, the net effect depends on tissue and timing. Researchers use SR9009 to probe how nuclear receptor signaling links the clock to metabolism, inflammation, and muscle biology. Findings are largely preclinical, and the precise contribution of each receptor subtype remains under study.
SR9009 is frequently discussed in fitness and research-chemical contexts, yet it has no approved medical indication. Regulatory agencies have not authorized it for human use, and it is not a standard prescription drug. Some sports organizations list it as a prohibited substance because of its potential performance-enhancing properties. Published human data are sparse, so claims about its effects in people often rely on animal models or anecdotal reports. Quality and identity of online materials can vary widely.
It scoffs at her for removing James' bracelet and reaches out to destroy Jesse's coffin when Lucie reveals herself and helps Grace fight. Jesse kills the demon, saving them. Lucie and Thomas Lightwood retrieve the plant to finish the antidote for the poison Christopher had developed. Thomas and Alastair create the elixir and go to the Silent City to distribute it, which is a huge success. After fleeing the city, James realizes that the person behind the attacks had to be his demonic grandfather. He enters the shadow realm to confront and stop Belial once and for all. After some time, Cordelia uses Cortana to cut through the Portal to help him. Belial reveals that the Mandikhor demon was raised partially in the physical world and partially in his realm, making it immune to sunlight. They battle the Mandikhor, but are gravely outmatched until James used his connection to Belial's realm to summon a tornado and kill it. Belial then approaches James to proposition him once again, to which Cordelia ran him through with Cortana. With Belial being severely wounded, the realm collapses, and James and Cordelia return to their own realm. Having been poisoned and depleted his strength when reaching into the realm, James is dying when they returned. Matthew tries healing runes, but they are not strong enough to save him. Unbeknownst to him, the ghost of Jesse Blackthorn gave James his last breath — which had been preserved in his locket to one day resurrect himself — saving his life. Days later, while still recovering from his ordeal, James is visited by Grace.
In that war, British submarines sank 2 million tons of enemy shipping and 57 major warships, the latter including 35 submarines. Among these is the only documented instance of a submarine sinking another submarine while both were submerged. This occurred when HMS Venturer engaged U-864; the Venturer crew manually computed a successful firing solution against a three-dimensionally maneuvering target using techniques which became the basis of modern torpedo computer targeting systems. Seventy-four British submarines were lost, the majority, forty-two, in the Mediterranean.
Anne S. Ulrich (born December 31, 1966) is a German chemist. She is the director of the Institute of Biological Interfaces (IBG-2) and Chair of Biochemistry at the Karlsruhe Institute of Technology. She studied chemistry at the University of Oxford - continued her doctoral work in the laboratory of Anthony Watts - held subsequent research positions as an EMBO-Fellow with Hartmut Oschkinat at the European Molecular Biology Laboratory in Heidelberg and as a Liebig-Fellow with Felix Wieland at the University of Heidelberg - became Associate Professor at the University of Jena - until she moved her group in 2002 to the Karlsruhe Institute of Technology. Her research focuses on the structural and functional analysis of biomembranes by solid state NMR. The main systems of interest are:
After several months of work, Fermi's group had tentatively determined that lighter elements would disperse the energy of the captured neutron by emitting a proton or alpha particle and heavier elements would generally accomplish the same by emitting a gamma ray. This latter behavior would later result in the beta decay of a neutron into a proton, thus moving the resulting isotope one place up the periodic table. When Fermi's team bombarded uranium, they observed this behavior as well, which strongly suggested that the resulting isotope had an atomic number of 93. Fermi was initially reluctant to publicize such a claim, but after his team observed several unknown half-lives in the uranium bombardment products that did not match those of any known isotope, he published a paper entitled Possible Production of Elements of Atomic Number Higher than 92 in June 1934. For element 93, he proposed the name ausenium (atomic symbol Ao) after the Greek name Ausonia for Italy. Several theoretical objections to the claims of Fermi's paper were quickly raised; in particular, the exact process that took place when an atom captured a neutron was not well understood at the time. This and Fermi's accidental discovery three months later that nuclear reactions could be induced by slow neutrons cast further doubt in the minds of many scientists, notably Aristid von Grosse and Ida Noddack, that the experiment was creating element 93.
=== Relation with kinetic theory and ideal gases === As the pressure on a gas increases, the volume of the gas decreases because the gas particles are forced closer together. Most gases behave like ideal gases at moderate pressures and temperatures. The technology of the 17th century could not produce very high pressures or very low temperatures. Hence, the law was not likely to have deviations at the time of publication. As improvements in technology permitted higher pressures and lower temperatures, deviations from the ideal gas behavior became noticeable, and the relationship between pressure and volume can only be accurately described employing real gas theory. The deviation is expressed as the compressibility factor. Boyle (and Mariotte) derived the law solely by experiment. The law can also be derived theoretically based on the presumed existence of atoms and molecules and assumptions about motion and perfectly elastic collisions (see kinetic theory of gases). These assumptions were met with enormous resistance in the positivist scientific community at the time, however, as they were seen as purely theoretical constructs for which there was not the slightest observational evidence. Daniel Bernoulli (in 1737–1738) derived Boyle's law by applying Newton's laws of motion at the molecular level. It remained ignored until around 1890, when John Waterston published a paper building the main precepts of kinetic theory; this was rejected by the Royal Society of England.
Sources: en.wikipedia.org
More generally, an NAD(P)H-hydrate epimerase (EC 5.1.99.6, NAD(P)HX epimerase) is a type of enzyme with systematic name (6R)-6beta-hydroxy-1,4,5,6-tetrahydronicotinamide-adenine dinucleotide 6-epimerase. Enzymes of this class, especially NAXE and its orthologs, catalyse the following chemical reaction
In January 2024, the first 11 US spot bitcoin ETFs began trading, offering direct exposure to bitcoin for the first time on American stock exchanges. In December 2024, bitcoin price reached $100,000 for the first time, as US president-elect Donald Trump promised to make the US the "crypto capital of the planet" and to stockpile bitcoin. The same month, BlackRock, the world's largest asset manager, recommended investors to allocate up to 2% of their portfolio to bitcoin. As of 2025, the Salvadoran government continues to describe Bitcoin as legal tender under the 2021 Bitcoin Law; however, a January 2025 reform removed obligations for businesses and the government to accept it, so many analysts regard its legal-tender status as effectively ended in practice. In March 2025, President Trump signed an executive order to establish a strategic bitcoin reserve. Later that year, some U.S. states, such as Texas and New Hampshire also instituted strategic bitcoin reserves, and the Czech National Bank bought less than €1 million in a "test portfolio".
Benzhydrocodone (INN; contracted from benzoate-hydrocodone) is an opioid prodrug of the morphinan class. Its chemical structure consists of hydrocodone coupled with benzoic acid. Benzhydrocodone itself is inactive and acts as a prodrug to hydrocodone upon cleavage of the benzoate portion of the molecule. It is designed to be an opioid analgesic with a low chance of recreational use. Created by Kempharm, Inc., a biopharmaceutical company in Coralville, Iowa, President and CEO, Travis Mickle, believes the molecular-based approach to abuse deterrent may be more effective than many formulation-based approaches. When approved, Apadaz received a labeling that highlighted all relevant aspects of the drug, including the lower abuse profile compared to traditional hydrocodone-acetaminophen. The labeling showed several items supporting a lower abuse profile than traditional hydrocodone-acetaminophen; namely, a lower Drug Liking in the first two hours after intranasal abuse (snorting), and the conversion of benzhydrocodone to hydrocodone in vitro being a "difficult process" — with benzhydrocodone being a more difficult drug to abuse according to FDA advisory committee documents.
Americium (95Am) is an artificial element, and thus a standard atomic weight cannot be given. Like all artificial elements, it has no known stable isotopes. The first isotope to be synthesized was 241Am in 1944. The artificial element decays by ejecting alpha particles. Americium has an atomic number of 95 (the number of protons in the nucleus of the americium atom). Despite 243Am being an order of magnitude longer lived than 241Am, the former is harder to obtain than the latter as more of it is present in spent nuclear fuel. Nineteen radioisotopes of americium, ranging from 229Am to 247Am have been characterized; another isotope, 223Am, has also been reported but is unconfirmed. The most stable isotopes are 243Am with a half-life of 7,350 years and 241Am with a half-life of 432.6 years. All of the remaining radioactive isotopes have half-lives that are less than seven days, the majority of which are shorter than two hours. This element also has fourteen meta states, with the most stable being 242m1Am (half-life 141 years). This isomer is unusual in that its half-life is far longer than that of the ground state of the same isotope.
Sources: en.wikipedia.org
The Roman author Vitruvius reported the health dangers of lead and modern writers have suggested that lead poisoning played a major role in the decline of the Roman Empire. Other researchers have criticized such claims, pointing out, for instance, that not all abdominal pain is caused by lead poisoning. According to archaeological research, Roman lead pipes increased lead levels in tap water but such an effect was "unlikely to have been truly harmful". When lead poisoning did occur, victims were called "saturnine", dark and cynical, after the ghoulish father of the gods, Saturn. By association, lead was considered the father of all metals. Its status in Roman society was low as it was readily available and cheap.
== Career == After gaining her doctorate, Ala-Kokko moved to Thomas Jefferson University in Philadelphia, United States, to carry out postdoctoral research in the group of Darwin Prockop. While there, Ala-Kokko focused her attention more directly on describing the structure, function and possible errors in genes that code for collagen proteins. She worked at Thomas Jefferson University as a research associate from 1987 to 1989, and as an instructor from 1989 to 1991. In 1990, Ala-Kokko was granted title of docent by the University of Oulu in the field of medical biochemistry. Her research work continued to be based in Philadelphia until 1997, when she was selected as a senior research fellow by the Academy of Finland. In the same year, Ala-Kokko also started at MCP Hahnemann University as an adjunct associate professor. In 2000, Ala-Kokko started work at the gene therapy centre of Tulane University in New Orleans. She worked there as an associate professor, and later became a full professor with tenure. In 2003 she was named professor of medical biochemistry and molecular biology at the University of Oulu. She left Tulane University in 2004. The company Connective Tissue Gene Tests was founded by Ala-Kokko in 2004 with her husband James Hyland. They offer over a thousand tests which function as molecular diagnostic tests of connective tissue disorders. As of 2018 her responsibility in the company is for research, development and technology. She is also responsible for overseeing all the tests that the company produces.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
=== Twin amino acid stereocentres === A subset of L-α-amino acids are ambiguous as to which of two ends is the α-carbon. In proteins a cysteine residue can form a disulfide bond with another cysteine residue, thus crosslinking the protein. Two crosslinked cysteines form a cystine molecule. Cysteine and methionine are generally produced by direct sulfurylation, but in some species they can be produced by transsulfuration, where the activated homoserine or serine is fused to a cysteine or homocysteine forming cystathionine. A similar compound is lanthionine, which can be seen as two alanine molecules joined via a thioether bond and is found in various organisms. Similarly, djenkolic acid, a plant toxin from jengkol beans, is composed of two cysteines connected by a methylene group. Diaminopimelic acid is both used as a bridge in peptidoglycan and is used a precursor to lysine (via its decarboxylation).
During FY2018, the federal government collected approximately $3.33 trillion in tax revenue, up $14 billion or less than 1% versus FY2017. Primary receipt categories included individual income taxes ($1,684B or 51% of total receipts), Social Security/Social Insurance taxes ($1,171B or 35%), and corporate taxes ($205B or 6%). Corporate tax revenues declined by $92 billion or 32% due to the Tax Cuts and Jobs Act. Other revenue types included excise, estate and gift taxes. FY 2018 revenues were 16.4% of gross domestic product (GDP), versus 17.2% in FY 2017. Tax revenues averaged approximately 17.4% GDP over the 1980-2017 period. During FY2017, the federal government collected approximately $3.32 trillion in tax revenue, up $48 billion or 1.5% versus FY2016. Primary receipt categories included individual income taxes ($1,587B or 48% of total receipts), Social Security/Social Insurance taxes ($1,162B or 35%), and corporate taxes ($297B or 9%). Other revenue types included excise, estate and gift taxes. FY 2017 revenues were 17.3% of gross domestic product (GDP), versus 17.7% in FY 2016. Tax revenues averaged approximately 17.4% GDP over the 1980-2017 period. Tax revenues are significantly affected by the economy. Recessions typically reduce government tax collections as economic activity slows. For example, tax revenues declined from $2.5 trillion in 2008 to $2.1 trillion in 2009, and remained at that level in 2010. From 2008 to 2009, individual income taxes declined 20%, while corporate taxes declined 50%.
Sources: en.wikipedia.org
It is a synthetic compound studied as an agonist of REV-ERB nuclear receptors. It is not an approved medicine and has mainly been examined in laboratory and animal research.
No. It is a small molecule that binds nuclear receptors involved in circadian regulation. Its classification differs from anabolic steroids or peptide hormones.
Published human clinical trial data are lacking. Most safety and activity information comes from preclinical models, so effects in people remain uncertain.
Liquid chromatography–mass spectrometry is common for identity and purity checks. High-performance liquid chromatography with ultraviolet detection can also be used. Both methods require a suitable reference standard.